PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00119572001
Common NameGSBRNA2T00119572001, LOC106423964
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 407aa    MW: 42809.9 Da    PI: 9.3388
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00119572001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.33.5e-3892151362
               zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          e+alkcprCdstntkfCy+nny+l+qPr+fCkaCrryWt+GGalr vPvGgg+r+nk+++
  GSBRNA2T00119572001  92 ETALKCPRCDSTNTKFCYFNNYNLTQPRHFCKACRRYWTRGGALRSVPVGGGCRRNKRTK 151
                          6789*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3875149IPR003851Zinc finger, Dof-type
PfamPF027015.6E-3294149IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.55395149IPR003851Zinc finger, Dof-type
PROSITE patternPS01361097133IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MVFSSFPTYP DSSNWQQQHQ PITTTVGFTG NNNISQQFLP HHPLPPQPQQ TPPPLQHNGN  60
GGGGGGPGGP GGLIRPGSMA ERARLANIPL PETALKCPRC DSTNTKFCYF NNYNLTQPRH  120
FCKACRRYWT RGGALRSVPV GGGCRRNKRT KNSGGGGASS SSGNSKSQDS TTSNDQYHHR  180
AMANNQMGPP TSTSLSSLLS SYNAGLIPGH DHNNNNNNIL GLGSSLSPLK LMHPSDFTDN  240
FTLQYGAVSA PSYHTGGGSS GGSGGGGASA ILTGLDQWRF PATHHQLPLL GGLDNSSSSG  300
LYPFDHQNPG YGLVTGSGQY RPKNIFHNLV SSSSSASSAM VPATASQLAS VKMEDSNNQL  360
NMSRQLFGNE QELWNIHGSA ASTAAASTNS WSDVSNNFSS SSTSNI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.145386e-86seed
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00483DAPTransfer from AT5G02460Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1896460.0AC189646.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrS009G14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013720160.10.0PREDICTED: dof zinc finger protein DOF5.1-like
SwissprotQ9LZ561e-168DOF51_ARATH; Dof zinc finger protein DOF5.1
TrEMBLA0A078ESE00.0A0A078ESE0_BRANA; BnaAnng00370D protein
STRINGBra028872.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM115191732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.11e-146Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]